PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007298m
Common NameCARUB_v10007298mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GRF
Protein Properties Length: 466aa    MW: 51312.7 Da    PI: 7.722
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007298mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.55.7e-24217260245
              WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       ep+rC+RtDGKkWRCsr+v++++k+CErH h++r rsrk++e+
  Carubv10007298m 217 LEPWRCKRTDGKKWRCSRNVIPDQKYCERHTHKSRPRSRKHVES 260
                      69***************************************997 PP

2QLQ51.92.4e-18111145236
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                      aF++aQ+q+L++Q  +yKy++a++PvP+eLl + +
  Carubv10007298m 111 AFSNAQWQELERQKNIYKYMMASVPVPSELLTPFP 145
                      8******************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.1E-10110146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.2E-11111143IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.056111146IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.842216260IPR014977WRC domain
PfamPF088791.2E-19218259IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MATRAERKED YVGGFGFGVV EHSHKDVMVL PHHHYHPSYS SPSSSSLCYC SAGLGDPMFS  60
VSSNQAYTSS HSDMFSLAGS TSASVTLADP FYTLSSSGEI GRSLSENAGA AFSNAQWQEL  120
ERQKNIYKYM MASVPVPSEL LTPFPKSHPS NTNPDGKISL AFTQTTSWRH ISKMFSTYAE  180
HKNLLWSLWM TVTVAVATGG SLQLGIASSA SNNTADLEPW RCKRTDGKKW RCSRNVIPDQ  240
KYCERHTHKS RPRSRKHVES SHQSSNHNDT RNAKNDTSQF TRAYPQFYGQ PVNQVPVLST  300
LPSSTSSYDH HRGLRWFRKE GDAIGTLNPE IHDAVQLKDG SSRELKRGFG YDLNFMQKEP  360
TVDQSFGALQ SLLSLNQTPH NQETRRFVVE GKQDEAMGSS LTLSMAGGSM EEAEETNQHQ  420
WVSHEGPSWL YSTTPGGPLA EALCLGVSNN PSSSTTTSSC SRSSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1096191e-175AL109619.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T19F6, partial sequence (ESSA project).
GenBankAL1615611e-175AL161561.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 61.
GenBankATAC0023431e-175AC002343.1 Arabidopsis thaliana chromosome IV BAC T19F6 genomic sequence, complete sequence.
GenBankCP0026871e-175CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285822.10.0hypothetical protein CARUB_v10007298mg
SwissprotQ9SU440.0GRF8_ARATH; Growth-regulating factor 8
TrEMBLR0H2280.0R0H228_9BRAS; Uncharacterized protein
STRINGAT4G24150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78362637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.10.0growth-regulating factor 8